SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 368408.Tpen_0830 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  368408.Tpen_0830
Domain Number 1 Region: 9-177
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.25e-16
Family Crotonase-like 0.049
Further Details:      
 
Domain Number 2 Region: 337-404
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000114
Family NfeD domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 368408.Tpen_0830
Sequence length 410
Comment (Thermofilum pendens Hrk 5)
Sequence
MKGRVGVFIAFSVFLLLCAVAYAQPRVVVVDLEGRIDEGAYYTVKRGLEEADKGVVVVVI
RSYGGYLKSMDKIVELLVSSEARTIAWVPPGERTVSAAAVIALSAQRLYMGKGAVIGSIK
PYPDDPKTVEYVVARVAALLSKKGVNDSRGLARRLVVDAQSFTSDEAVATGIADGTADSL
AELLQKEGLSFASVHYVSGDLVSDLLSVLLDPALAVLLALLGAMLLLLEFKVTGFQGWGV
IGAALIVISLYSFDVIGVSLSTFILALLGITLIIVELAKPGVQVAGIAGVALIALAVILE
YASRPYPVFTPNVLVVAVPLAILVLLLAVVISKALETVRMKAPSLQERLIGKIGVAKTRI
EPGKRGVVYVDGEDWTATSEYVVEEGESVEVVALDGLFLKVKPVRREHSQ
Download sequence
Identical sequences A1RYF1
368408.Tpen_0830 gi|119719739|ref|YP_920234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]