SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3694.estExt_Genewise1_v1.C_LG_X6499 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.estExt_Genewise1_v1.C_LG_X6499
Domain Number 1 Region: 521-640
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.87e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.estExt_Genewise1_v1.C_LG_X6499
Sequence length 652
Comment (Populus trichocarpa)
Sequence
MEPNASNSLQPDHCLEITPMEVHKVVPPPHRSTIQKLKSRLKETFFPDDPLRQFKGQPLG
KKWILAAKYFFPILQWGPNYSFKLFKSDIVSGLTIASLAIPQGISYAKLASLPPIVGLYS
SFVPPLVYAVLGSSRDLAVGPVSIASLILGSMLKQEVSPTNDPLLFLQLAFSSTFFAGLF
QASLGLLRLGFIIDFLSKATLIGFMAGAAIIVSLQQLKSLLGITHFTKQMELVPVLSSVF
HNTNEWSWQTVLMGFCFLVFLLLARHVSMKKPKLFWVSAGAPLVSVILSTVLVFAFKAQR
HGISVIGKLQEGLNPPSWNMLHFHGSYLGLVVKTGLVTGIISLTEGIAVGRTFAALKNYQ
VDGNKEMMAIGLMNVIGSATSCYVTTGAFSRSAVNHNAGAKTAVSNIIMSVTVMVTLLFL
MPLFQYTPNVVLGAIIVTAVIGLIDIPAACQIWKIDKFDFVVMLCAFFGVILVSVQDGLA
IAVGISIFKILLQVTRPKTVVLGNIPGTDIFRNLHHYKEAMRIPGFLILSIEAPINFANT
TYLKERILRWIDEYETEEDTKRQSSIHFLILDLSAVSSIDTSGVSLLKDLKKALENTGAE
LVLVNPGGEVLEKLQRADDVRDVMSPDALYLTVGEAVAALSSTMKGRSSNHV
Download sequence
Identical sequences 3694.estExt_Genewise1_v1.C_LG_X6499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]