SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00040083 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00040083
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000182
Family Ubiquitin-related 0.0062
Further Details:      
 
Domain Number 2 Region: 79-149
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000018
Family Ubiquitin-related 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00040083
Sequence length 152
Comment (Populus trichocarpa)
Sequence
MTLKVKVVADGTTMIPMELPDDATVKDLKEAVHDMFNCFSVENQELLFNGLLLQDNTKLA
SYRLVSDSEITLRLLFTIVIIGKNPDGQYQRYEVRAHRNNYVGDLKLKLSEDHGLDITNI
RLQMGPESYLLDRTLLWANRISSGTRIYIAEE
Download sequence
Identical sequences 3694.eugene3.00040083 3694.eugene3.35890001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]