SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00060874 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00060874
Domain Number 1 Region: 78-153
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000159
Family Ubiquitin-related 0.027
Further Details:      
 
Domain Number 2 Region: 15-81
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000553
Family Ubiquitin-related 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00060874
Sequence length 170
Comment (Populus trichocarpa)
Sequence
MATITSTIVGAKVTLTFEMLPLCTIGEVKQKITERTNLNRNRLTLRGGHNLEELEDYRTL
EECRYRGEATIHLDVSPLSGNPEFDIAVGLPNNDWKAMKVRETTTVAELKDKIMERWGIP
TCRMTLTRLDTTMEEDSSSLIDYYISLMGVIRVLEHETKEVVESEEGGET
Download sequence
Identical sequences B9HCX0
XP_002309142.1.11743 POPTR_0006s10160.1|PACid:18211061 3694.eugene3.00060874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]