SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00120450 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00120450
Domain Number 1 Region: 135-383
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.67e-50
Family D-glucarate dehydratase-like 0.00013
Further Details:      
 
Domain Number 2 Region: 25-148
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.31e-21
Family Enolase N-terminal domain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00120450
Sequence length 387
Comment (Populus trichocarpa)
Sequence
MAGSNPKQVSTFEFRDLMETFAVDVKRAENRPLNVPLIAPFTIASSRLDKVENVAIRIEL
SDGCVGWGEAPILPFVTAEDQSTAMIKAREACELLKNSSSMKLGLVLERVSEILPGHEFA
SVRAGVEMALIDAVAKSINVPLWILFGGASDSITTDITIPIVSSAEAAELASKYRKQGFQ
TLKLKVGKNLKEDIEVLQAIRAVHPDCLFILDANEGYKPEEAIEVLEELHKMGVTPILFE
QPVHRDDWEGLGHVTHIAKGKYGVSVAADESCRSLVDAKRIIKGNLADVINIKLAKVGVV
GGLEIIEEARTSGLDLMIGGMVETRLAMGFAGHLAAGFGCFKFIDLDTPLLLSEDPVLEG
YEVSGAVYKFTDAQGHAGFLDWDNVLW
Download sequence
Identical sequences 3694.eugene3.00120450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]