SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00180133 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00180133
Domain Number 1 Region: 29-154
Classification Level Classification E-value
Superfamily TPR-like 0.000000000176
Family Tetratricopeptide repeat (TPR) 0.0088
Further Details:      
 
Weak hits

Sequence:  3694.eugene3.00180133
Domain Number - Region: 661-710
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0157
Family Anti-sigma factor antagonist SpoIIaa 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00180133
Sequence length 1974
Comment (Populus trichocarpa)
Sequence
MFSIAAINDTDSKEQWEPLAPTKEAQAPKEYDKACELLESVLKDPLISNAQADRNASDGH
LLQLRFLVLKNLATVFLQQGPSHYESALRCYLQAVEIDTKDSVVWNQLGTLSCSMGLLSI
SRWAFEQGLLCSPNNWNCMEKLLEVLIAIGDEVACLSVAELILRHWPSHSRALHVKNTIE
ESEPVPFSPRGIDKLEPKHVRLKFLDKRKATNENLDEGIACKRANHNIELLLPEVSWAAL
TDAILEILLKLNGFGSEMGGDTVCRSGDIRLTINMPSNMEIIMESVEKKGSKSIPSVQSM
SFVDCNSERASSVKERDPNIIDEQPHERRSTRLRSRKPGKEELDFDTRKDLAKVVVQLIE
PFIVKNEDSDLVGSCSVPCFDQANSLDTEHNDVADFVRETSKNYGAYHMGHLLLEHAASR
GLKYQDAFVKFLELERLTRHWGRDRTPECCLFLAELYYDLGSLPSNVSKMSEYLSEASYH
LCKIIESVALDYPFHLTHVSGNINFSSDKSFQDSDETLKEGTGGWDSLLNISLLDNKSSF
WVRYFWLSGKLSIVDGNKAKAHGEFCISLSVLAKKEVTNSAPSVCLPHLKIDKELTVDRI
LHGINLLKLDLLLEKTVGEKIEKEMYSDCIDLLAPLLFSSKHVHLNVLPLPAADKKGEEF
TCIELSALDTLIEACEKAKPMEIEVCLKSHQRKLEILLILAGMDGYVTFHQKSELKAYFA
SDIVSKENPEKHWNDLVMEEVKAISQCVSQFKNFLGPSVDSNGKIIHFGSIGDIQSLLLA
VMCHIANYLSKKSSVPAISEELEQKQICCFVDAGIAYCKLQHLVHTIPVKTQVELIVAIH
DLLAEYGLCCAGGDGEGEEGTFLKFAIKHLLALDMKLKSNSNSSNIEAIQHDDKLYSPNK
TFKTETILNTLGVEGGGAEINEVSATMSDGFGGISSKDVSSPAGLEKDHADVECRKVGGN
EGKNKGEKPIEHINELSEDEREELELLIDNALDQCFFCLYGLNIRSDSSYDDDLATHKNT
SRGDYQSKEQCADVFQYILPCARASSLCAYASQKTGLIKLRRVLRAIRKHFPQPPEEVLA
GNAIDKFLDDPDLCEDKLSDEAGSEGYLETITKVIFPDAGSVKQHRALMVRSSEPYFEVY
CNLYYFLALSEEMNATDKWPGFVLTKEGEEFVQQNANLFKYDLLYNPLRFESWQRLGNTY
DEASLNVFLFSLKQEVDLLLNDGSKHINVAGWRKNVTLPQRVDTSRRRSRRCLLMSLALA
KTPAQQCEIHELLALVCYDSLQNVVPFYDQRSAIPSKDAVWMAFCENSLKHFKKAHTQKQ
DWSHAFYMGKLCEKLGYSYETSLSYYSVAIALNSSAVDPVYRMHASRLKLLCKSGRLNLE
VLKVLAEYSFNESTKDSVMSILSTFAPEVSCSADNIEDISTEESFERKHEESVQLEEVWQ
MLYNDCISALEVCVEGDLKHFHKARYMLAQGLYKRGLNGDLERAKDELSFCFKSSRSSFT
INMWEIDGMVKKGRRKTPGFSGNKKALEVNLPESSRKFITCIRKYLLFYLKLLEETGDIC
TLDRAFISLRADKRFSLCIEDLVPVALGRFIKTLILSISQVETADSGVPGNSGQQLEKMF
SLFMEQGNLWPEILSLPEIRSPVISESSLYGYLHRYIASLEGNGKLETLEAINEKIRKRF
KNPKLSNSNCAKVCRHASFAWCRSLIISLALITPVQSGLQSEIHALNSSDSNLESSLLLC
IDLQTNELWSQSFEDSTSLGNLETKWNPMLSRIKNIVIKKVSDENIETATSLFRSSYNFY
RESSCVMLPSGINLCLVPSRLAVQAQVQPNLDGVEILDLSIPRKLLLWAYALLHGRYANI
SVVVKHCEENVKSKMKKGPGTSFVPSNASLPAATVIHTGGGKDSATQGGSNEPEVPLVSV
PVTAVTSVSLSEGDSIQCTNPPLTSDEGQKILFATPQQNQDNSTPDGRNFAMNE
Download sequence
Identical sequences 3694.eugene3.00180133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]