SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.01570002 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.01570002
Domain Number 1 Region: 517-627
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.18e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.01570002
Sequence length 648
Comment (Populus trichocarpa)
Sequence
MPTPNSSMNPTQVNFNSPRKFRTTLKSKCKETFFPDDPFRQFKNEKPLGKAKKTLQYFVP
IFEWLPQYNLKMFRFDLLAGITITSLAIPQGISYAKLAEIPPIIGLYSSFVPALVYAILG
SSKHVAVGTVAACSLLIADTIGSKVSSKDDPTLYLHLVFTAAFITGVFQAALGFLRRLNT
CRLGILVDFLSHSTITGFMGGTAIIICLQQLKGLLGVSHFTTKTDVVSVLHAVFKNRNEW
KWETAVVGMAFLVFLLFTRYLRQRKPKLFWVSAMAPMVVVVLGCLLAYFTRDSKYSIQTV
GNLHKGLNPISIEYLNFDAEYLPYTLKAGIITGIIALAEGIAIGRSFAIMNNEQVDGNKE
MIAFGFMNIVGSCFSCYLTTGPFSKTAVNYNSGCKTAASNLVMAIGMMLTLLFLAPLFSY
TPLVALSAIIMSAMLGLIKYEEAYHLFKVDKFDFCICLAAFFGVAFITMDMGLMISVALA
LLRALLYVARPAACKLGKLPDSTLYRDTEQYAEASGPPGILAIQLGSPIYYANGNYIRER
ILRWIRNDEGNGKAVKHVLLDLTGVTSIDTTGIETLAEVLRILEVKHIKMKIVNPRLDVL
EKMMKSKFVDKIGKESIFLCMEDAVEASYDFSATTEKQGFEEQRSGVA
Download sequence
Identical sequences 3694.eugene3.01570002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]