SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.fgenesh4_pg.C_scaffold_13026000001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.fgenesh4_pg.C_scaffold_13026000001
Domain Number 1 Region: 75-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.35e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 2 Region: 152-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.8e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 3 Region: 228-304
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.8e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 4 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.93e-33
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 5 Region: 304-377
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.98e-32
Family Ubiquitin-related 0.0000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.fgenesh4_pg.C_scaffold_13026000001
Sequence length 377
Comment (Populus trichocarpa)
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
ADYNIQKESTLHLVLRL
Download sequence
Identical sequences 3694.fgenesh4_pg.C_scaffold_13026000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]