SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.fgenesh4_pg.C_scaffold_256000016 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.fgenesh4_pg.C_scaffold_256000016
Domain Number 1 Region: 21-110
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000569
Family B3 DNA binding domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.fgenesh4_pg.C_scaffold_256000016
Sequence length 123
Comment (Populus trichocarpa)
Sequence
MADPEPQLNLFENHPKDGEFHYLFRKKLTHSDLWLGLILVGKRSKEHLLELKNSSASVKL
YTPASANTSVSFQRHGRQSTVQLSKVGWTEIATSNGFVEDDEIDCWRIKIWFLIDKGRLL
MVV
Download sequence
Identical sequences B9NBK1
XP_006382525.1.11743 POPTR_0005s03000.1|PACid:18207260 3694.fgenesh4_pg.C_scaffold_256000016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]