SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.fgenesh4_pg.C_scaffold_9831000001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.fgenesh4_pg.C_scaffold_9831000001
Domain Number 1 Region: 52-109
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000239
Family SH3-domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.fgenesh4_pg.C_scaffold_9831000001
Sequence length 110
Comment (Populus trichocarpa)
Sequence
MSLGKKAVASRLPKVFQVTYRNGRYHLLRVMIEILFLMSSGKLTEYVIAFLDYLHKINKE
TSVSSPLSVEIAQVIAAYQAQGDEQLSLSPGQFIKVKKKNGSGWWEGELQ
Download sequence
Identical sequences 3694.fgenesh4_pg.C_scaffold_9831000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]