SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3694.fgenesh4_pm.C_LG_X000302 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.fgenesh4_pm.C_LG_X000302
Domain Number 1 Region: 510-627
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.92e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.fgenesh4_pm.C_LG_X000302
Sequence length 653
Comment (Populus trichocarpa)
Sequence
MGNDYYYECPHPVAIPPAKPFIESIKSGIKETLFPDDPFRQFKNQPASRKFILGLQYFVP
VLEWAPRYTFEFFKADLIAGITIASLAVPQGISYASLANLPPILGLYSSFVPPLVYAMLG
SSKDLAVGTVAVASLLISSMLGKEVNPNENPKLYVQLALTATFFAGVFQAALGFLRLGFI
VDFLSHATIVGFMGGAATVVCLQQLKGILGLVRFTHGTDLVSVMRSVFSQAHQWRWESGV
LGCCFLFFLILTRYVSKRKPGFFWISAMAPLTSVIVGSVLAYLTHAEQNGVQVIGHLKKG
LNPPSVSELAFGSPYLMTAIKTGIITGVIALAEGVAVGRSFAMFKNYHIDGNKEMIAFGM
MNIAGSCTSCYLTTGPFSRTAVNFNAGCKTAVSNIVMATAVMITLLFLTPLFHYTPLVVL
SSIIIAAMLGLIDYEAAISLWKVDKCDFIVCMSAYFGVVFGSVEIGLVIAVAISLLRMLM
SVARPRTFLLGNIPNSMIYRSIDQYPIANNVPGVLILQIDAPVYFANANYLRERISRWIY
EEEEKLKSTGGSSLQYVILDLSAVGSIDTSGISMLEEVKKNIDRRDLKLVLANPRSEVIK
KLEKSKFMESIGQEWIYLTVGEAVAACNFMLHRSKSSNNPATEKVELDAHDNV
Download sequence
Identical sequences B9HUR7
XP_002314667.1.11743 3694.fgenesh4_pm.C_LG_X000302 POPTR_0010s09280.1|PACid:18240916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]