SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3694.grail3.0033027401 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3694.grail3.0033027401
Domain Number - Region: 1-36
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.012
Family HLH, helix-loop-helix DNA-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.grail3.0033027401
Sequence length 155
Comment (Populus trichocarpa)
Sequence
MLDEVIEYLKQLQAQVQMVSRMNMQPMMLPMALQQQLQMSMMAPISMGMAGMGMGMGMGM
GMGVVDMNTLAARSNITGVSPVLHPTAFMPMPTWDGSNSHERLPTAAPSATVMPDPLSAF
LACQSQPMTMDAYSRMASMYQQLHQQSPASNSKSV
Download sequence
Identical sequences 3694.grail3.0033027401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]