SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3694.grail3.3192000301 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.grail3.3192000301
Domain Number 1 Region: 224-288
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000196
Family NfeD domain-like 0.0057
Further Details:      
 
Weak hits

Sequence:  3694.grail3.3192000301
Domain Number - Region: 5-52
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0273
Family Clp protease, ClpP subunit 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.grail3.3192000301
Sequence length 295
Comment (Populus trichocarpa)
Sequence
MTRKQMHDASAYIRGLAQLRHRNADWGERAVREAVSLSADEAVAQHVADLIAADLPVLLR
QVDGKRIEAAGAMRTLHTAGAPVVTLEPDWRSRLLAVITDPSVALILMMIGIYGLIFEFS
TPGMVVPGIAGAICLLLGLFALQMLPVNYAGLALIALGVGCMTAELFLPTFGALGVGGII
AFAFGAVMLIDTDVPGFGVPLSLIATLSTVSAVFLFGMSMVLLRARRRPVVSGADALVGS
IGVVIDDAPADGWATVHGEQWRIHSAAPLVRGQRVRVTARRGLVLDVTTAGDPSA
Download sequence
Identical sequences 3694.grail3.3192000301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]