SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3694.gw1.IV.3720.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.gw1.IV.3720.1
Domain Number 1 Region: 553-729
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.36e-44
Family Ankyrin repeat 0.00028
Further Details:      
 
Domain Number 2 Region: 328-517
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.77e-41
Family cAMP-binding domain 0.00062
Further Details:      
 
Domain Number 3 Region: 73-324
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-37
Family Voltage-gated potassium channels 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.gw1.IV.3720.1
Sequence length 821
Comment (Populus trichocarpa)
Sequence
SNNDDDEDGTEYEVQDLRDRIKSSRGSRFNLLENEFGLVNNTESSLITNLRRKLSRESVI
NGIRYVSTGPAIHPDNRWYRAWTIFILLWAVYSSFFTPMEFGFFRGLPENLFIMDIVGQV
AFLLDIVLQFFVAYRDSQTYRMIYKRSPIALRYLKSHFIIDLLGCLPWDIIFKVCGRREE
VRYLLWIRLSRVRKVTSFFQKLEKDIRINYLFTRIVKLIVVELYCTHTAACIFYYLATTL
PASHEGYTWIGSLKMGGYNYTNFREIDIWMRYTTSLYFAVVTMATVGYGDIHAVNLREMI
FVMIFVSFDMILGAYLIGNMTAITVKGSKTEKFRDKMTDLIKYMNRNRLGKDIRNQIKGH
LRLQHESSYTEASALQDLPISIRAKISQTLYTEYIEKVPLVKDCSAEFINQIVIRLHEEF
FLPGEVIMEQGNVVDQLYFVCHGVLEEVGIGQDGSEETVKLLPPNSSFGEISILCNIPQP
YTVRVCELCRLLRIDKQSLSNILEIYFYDGRRILDNLLEGKESNLQYKQLESDITFHIGK
QEAELALRVNSTAYHGDLYQLKGLIRAGADPNRTDYDGRSPLHLAASRGYEDTTLFLIQE
GVDINIKDKFGNTPLLEAIKNGHDRVASLLSEQGAILNIDDAGSVLCRAVARGDSDFLKR
VLSNGIDPNSKDYDHRTPLHVAASEGLYLMAKLLIEAGASVFSKDRWGNTPLVEGRICGN
KNLIKLLEEAKSSQKLEFHYASHETTEKMLPKKCTIFPFHPWGAKEQRRPGVVLWIPHTM
EELVKAASEKLQLPDGSCILSEDAGKILEVDMIDDGQKLYL
Download sequence
Identical sequences 3694.gw1.IV.3720.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]