SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3694.gw1.IX.3951.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.gw1.IX.3951.1
Domain Number 1 Region: 185-475
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.41e-107
Family Enolase 0.0000000364
Further Details:      
 
Domain Number 2 Region: 47-180
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.19e-49
Family Enolase N-terminal domain-like 0.00000652
Further Details:      
 
Weak hits

Sequence:  3694.gw1.IX.3951.1
Domain Number - Region: 3-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0628
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.gw1.IX.3951.1
Sequence length 476
Comment (Populus trichocarpa)
Sequence
MSVQEYLDKHVLSRKIEDAVNAAVRAKTPDPVLFISNHMRKAVPSVITKIKGRQILDSRG
IPTVEVDLFTNKGSFRASVPSGHVTGMYEAVELRDGDKGMYLGNSVTRAVKNINEKISEA
LIGMDPTLQSQIDQAMIDLDKTEKKGELGANAMLAVSIAACKAGAAEKEAVPLYKHISDL
SSKTNPTLPVPAFTVISGGKHAGNNLAIKEIMILPIGASTFEEALQMGSETYHHLKAVIK
EKYGEQGCNVGEDGGFSPNLSRQLPVQEGLNLVKEAISRTGYSEKIKMAIDVAATTFCIG
TKYDLDYKFQNKSGQNFKSGDDMIKMYEELCAAYPIVSIEDPFDREDWEHVKRFSDLGLC
QVVGDDLLMSNHKRIERAIHESSCTALLLKVNQIGTVTEALEVVKLAKDAHWGVVVSHRS
GETEDSFIADLSVGLAMGQIKTGAPCRGERLAKYNQLLRIEEELGDQAVYAGEDWR
Download sequence
Identical sequences 3694.gw1.IX.3951.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]