SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 369723.Strop_1287 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  369723.Strop_1287
Domain Number 1 Region: 13-170
Classification Level Classification E-value
Superfamily RNase III domain-like 1.4e-45
Family RNase III catalytic domain-like 0.0000734
Further Details:      
 
Domain Number 2 Region: 122-234
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.56e-27
Family Double-stranded RNA-binding domain (dsRBD) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 369723.Strop_1287
Sequence length 252
Comment (Salinispora tropica CNB-440)
Sequence
MSIDKRRRPVVGHLEAAFGVALDPELLERALTHRSYAYENGGLPTNERLEFLGDSVLGVV
ITTALFHNHPDLPEGQLAKLRASVVNMRALAEVARGLGPTGLGPYLLLGKGEESTGGRDK
ASILADTLEALLGAIYLESGLETVATVIHRLFDPLMAESAGRGAALDWKTSLQELTAAQG
LGVPEYRIEGTGPDHLKTFTAWVVVAGRRYGGAEGRSKKEAEQRAAEAAWRTLTEQAEQE
PASAGSGAAGSA
Download sequence
Identical sequences A4X4F7
gi|145593838|ref|YP_001158135.1| WP_011905189.1.12452 WP_011905189.1.28039 WP_011905189.1.3277 WP_011905189.1.3377 WP_011905189.1.34286 WP_011905189.1.43425 WP_011905189.1.57249 WP_011905189.1.65288 WP_011905189.1.69032 WP_011905189.1.88928 WP_011905189.1.9676 369723.Strop_1287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]