SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 369723.Strop_1558 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  369723.Strop_1558
Domain Number 1 Region: 79-311
Classification Level Classification E-value
Superfamily MetI-like 1.19e-62
Family MetI-like 0.00017
Further Details:      
 
Weak hits

Sequence:  369723.Strop_1558
Domain Number - Region: 37-68
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.0405
Family MalF N-terminal region-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 369723.Strop_1558
Sequence length 322
Comment (Salinispora tropica CNB-440)
Sequence
MSHSTTTAPATPAVPPPPDGTPTRRRPFLSRLDITYSPYLYIAPFFLIFGIFGLYPMLRT
AWMSLHDWDMIGDRTFIGLDNYTRLLTDEYFWNALVNTFGIFALSTIPQLLLALFLANLL
NRTLLRAKTFFRMAIFIPNVVSVAAVAIVFGMLYQREYGLVNWLLGFVGIDQIDWDGQTW
SSWTAIASMVNWRWTGYNTLILLAGMQAIPRDLYEAAEIDGAGQWRQFWRITLPLLRPTF
IFVVILSTIGGMQLFTEPLLFANGNIIGGTQREFQTLAMYMYEMGITNLNSAGYGAAVAW
ALFMIIGLMSLLNFVLVRRAAK
Download sequence
Identical sequences A4X574
gi|145594105|ref|YP_001158402.1| WP_011905456.1.28039 WP_011905456.1.3277 WP_011905456.1.34286 WP_011905456.1.43425 WP_011905456.1.57249 WP_011905456.1.88928 369723.Strop_1558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]