SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 369723.Strop_3019 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  369723.Strop_3019
Domain Number 1 Region: 90-152
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000562
Family NfeD domain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 369723.Strop_3019
Sequence length 167
Comment (Salinispora tropica CNB-440)
Sequence
MTRAPACHDRGVDAVLWIVVGVVLAVAEIFTTTLFLIMFAVGAFAAAGAAALGAPVEIQA
VVFAVVSALTLLGARPALRRRTTLTSTEDRAFGVGAIEGNTALVLERVDADNGLVKIDGE
LWQARSYDATQVFAPGDRVQVIQVRGATAQVWRDDVSRPGELPETKR
Download sequence
Identical sequences A4X995
gi|145595537|ref|YP_001159834.1| 369723.Strop_3019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]