SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 369723.Strop_3391 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  369723.Strop_3391
Domain Number 1 Region: 12-102
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.51e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 369723.Strop_3391
Sequence length 120
Comment (Salinispora tropica CNB-440)
Sequence
MSLSIVKSFLPRSVVEISPRGEIDVDTAYEVREAVAEILAKGRPRRIELNMRLVTFIDSV
GISAMVAGFQTAEVSGVKLVVTEPSRFVHRQLWVAGLLGLFGAPEPYFAGAAAPEVLPGA
Download sequence
Identical sequences A4XA78
369723.Strop_3391 gi|145595905|ref|YP_001160202.1| WP_012014599.1.12452 WP_012014599.1.28039 WP_012014599.1.3277 WP_012014599.1.3377 WP_012014599.1.34286 WP_012014599.1.43425 WP_012014599.1.57249 WP_012014599.1.65288 WP_012014599.1.69032 WP_012014599.1.88928 WP_012014599.1.9676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]