SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 369723.Strop_4032 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  369723.Strop_4032
Domain Number 1 Region: 44-148
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.12e-27
Family Anti-sigma factor antagonist SpoIIaa 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 369723.Strop_4032
Sequence length 151
Comment (Salinispora tropica CNB-440)
Sequence
MGSVGSGRGACPTGRWWYPVSPVVMVECPWRVYGSCEEDLMELSLATRTVGEFAVVVVGG
EVDVYTAPQLREGLLELIDAGVEHVVVDLGGVDFLDSTGLGVLVGALKRLRTVGGSFALV
CDREPLLKIFRITALDQVFPLYPTVDAATGV
Download sequence
Identical sequences A4XC05
369723.Strop_4032 gi|145596543|ref|YP_001160840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]