SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 369723.Strop_4101 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  369723.Strop_4101
Domain Number 1 Region: 6-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.35e-22
Family Anti-sigma factor antagonist SpoIIaa 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 369723.Strop_4101
Sequence length 107
Comment (Salinispora tropica CNB-440)
Sequence
MGRAELSITLHRLGDEVVLRLAGEIDMLTATQLSTVVNEVLAEPPPRIVLDLAGVTFCDS
QGLGTLVVLSRKTSHSQSLLVLTNVADFLLRVLDITGLRSALMIRDD
Download sequence
Identical sequences A4XC74
gi|145596612|ref|YP_001160909.1| WP_012015299.1.12452 WP_012015299.1.28039 WP_012015299.1.3277 WP_012015299.1.3377 WP_012015299.1.34286 WP_012015299.1.43425 WP_012015299.1.57249 WP_012015299.1.65288 WP_012015299.1.69032 WP_012015299.1.88928 WP_012015299.1.9676 369723.Strop_4101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]