SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT1G09030.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT1G09030.1-P
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily Histone-fold 4.33e-39
Family TBP-associated factors, TAFs 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3702.AT1G09030.1-P
Sequence length 139
Comment (Arabidopsis thaliana)
Sequence
MTDEDRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASEKCHRENRK
TVNGDDIWWALSTLGLDNYADAVGRHLHKYREAERERTEHNKGSNDSGNEKETNTRSDVQ
NQSTKFIRVVEKGSSSSAR
Download sequence
Identical sequences A0A178WJ11 C0SUU0 O04027
NP_172377.1.80155 AT1G09030.1 AT1G09030.1 3702.AT1G09030.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]