SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT4G10480.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3702.AT4G10480.1-P
Domain Number - Region: 173-210
Classification Level Classification E-value
Superfamily UBA-like 0.000265
Family UBA domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3702.AT4G10480.1-P
Sequence length 212
Comment (Arabidopsis thaliana)
Sequence
MPGPVIEEVNEEALMDAIKEQMKLQKENDVVVEDVKDGDEDDDDVDDDDDEIADGAGENE
ASKQSRSEKKSRKAMLKLGMKPVTDVSRVTIKRSKNVLFVISKPDVFKSPNSETYVIFGE
AKIDDMSSQLQAQAAQRFKMPDVASMIPNTDGSEAATVAQEEEDDEDVDETGVEAKDIDL
VMTQAGVSRPKAVKALKESNGDIVSAIMELTT
Download sequence
Identical sequences A0A178V0D1 Q0WWN5 Q9SZY1
AT4G10480.1 AR2453 GO.17348 AT4G10480.1 NP_192786.1.80155 3702.AT4G10480.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]