SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3702.AT5G25540.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3702.AT5G25540.1-P
Domain Number - Region: 83-127
Classification Level Classification E-value
Superfamily UBA-like 0.000638
Family CUE domain 0.039
Further Details:      
 
Domain Number - Region: 32-80
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00418
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3702.AT5G25540.1-P
Sequence length 175
Comment (Arabidopsis thaliana)
Sequence
MKSGSSTLNPYAAAYVPLSKREGSLVDTKPVTQQHMQQQHHQQQPYYGYGVQGMGSYQGT
QMSPKKSPSEMVYNHQLKDEDLEMDMDIEYLLATYPGLSQESINDVYLANTCDLDATIEM
LNQLEIYSTEAEEYLPDTLDIGDVPEIITESSKQKNDGSSASSSSGIRNANVSSS
Download sequence
Identical sequences A0A178U9D7 Q6NQH9
GO.19470 3702.AT5G25540.1-P AT5G25540.1 AT5G25540.1 NP_001331123.1.80155 NP_197936.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]