SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 370438.PTH_1661 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  370438.PTH_1661
Domain Number 1 Region: 2-194
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.09e-38
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 370438.PTH_1661
Sequence length 201
Comment (Pelotomaculum thermopropionicum SI)
Sequence
MKLDIVISGVGGQGSVLASRALARAAMESGLAVRTSEVIGMAQREGPVTSHIRMGDRLYG
AIIPDRAADFLLGLELAETVRGLIKLKPGGTVIASLSAIVPVSVELGISKYDKDTLIQYL
IEQNEKVFFLDLEELSRQSGHPRTGNAVMLGALSAFPGLPFKPEQLLRSLLSYLPQSLAE
INRRAFEIGRRAVEVTLNDIN
Download sequence
Identical sequences A5D1P0
gi|147677996|ref|YP_001212211.1| 370438.PTH_1661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]