SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 370438.PTH_2106 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  370438.PTH_2106
Domain Number 1 Region: 69-135
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0000129
Family Family 1 bi-partite nucleotidyltransferase subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 370438.PTH_2106
Sequence length 144
Comment (Pelotomaculum thermopropionicum SI)
Sequence
MKFNGDRMKSILSEYLQGVKRLEELAALKEEEFVADPHKVASAKYHLVICIEAAIDICNH
IIAKNRLRVPEDYADTFRIMGENGLFSQDFLPKLFAMTGFRNRLVHRYWDVDSKKVYSIL
QENLPDLYQLINELKARIPIMLNL
Download sequence
Identical sequences A5D0D6
370438.PTH_2106 gi|147678441|ref|YP_001212656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]