SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 370551.MGAS9429_Spy0817 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  370551.MGAS9429_Spy0817
Domain Number - Region: 9-29
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0235
Family NfeD domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 370551.MGAS9429_Spy0817
Sequence length 47
Comment (Streptococcus pyogenes MGAS9429)
Sequence
MWKSATDHLNDFIDKNKYAKVTGDLWQGSDQVIAEQCFLKVLEEMQK
Download sequence
Identical sequences Q1CQS6
gi|94988190|ref|YP_596291.1| gi|94988448|ref|YP_596549.1| 370551.MGAS9429_Spy0559 370551.MGAS9429_Spy0817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]