SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 373384.SFV_0461 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  373384.SFV_0461
Domain Number 1 Region: 91-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000889
Family NfeD domain-like 0.0079
Further Details:      
 
Weak hits

Sequence:  373384.SFV_0461
Domain Number - Region: 28-77
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000641
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 373384.SFV_0461
Sequence length 148
Comment (Shigella flexneri 5 8401)
Sequence
MVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLVPLGWEWQGVMFAILT
LLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSSWPVS
ASEDLGAGTHVEVIAIEGITLHIRAVSS
Download sequence
Identical sequences A0A073FZT6 A0A0F6MAI0 A0A0Q3YYD6 A0A125X7X5 E7SMU9 E7TBN4 F5NRK5 G0FCZ3 H4UFH8 I2XGJ8 I6EUC6 I6G791 K0XKP1 Q0T798
373384.SFV_0461 gi|110804513|ref|YP_688033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]