SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 373384.SFV_1563 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  373384.SFV_1563
Domain Number 1 Region: 98-388
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.01e-77
Family D-glucarate dehydratase-like 0.00016
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.66e-34
Family Enolase N-terminal domain-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 373384.SFV_1563
Sequence length 404
Comment (Shigella flexneri 5 8401)
Sequence
MKIVKAEVFVTCPGRNFVTLKITTEDGITGLGDATLNGRELSVASYLQDHLCPRLIGRDA
HRIEDIWQFFYKGAYWRRGPVTMSAISAVDMALWDIKAKAANMPLYQLLGGASREGVMVY
CHTTGHSIDEALDDYARHQELGFKAIRVQCGIPGMKTTYGMSKGKGLAYEPATKGQWPEE
QLWSTEKYLDFMPKLFDAVRNKFGFNEHLLHDMHHRLTPIEAARFGKSIEDYRMFWMEDP
TPAENQECFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTLTHAGGITGMRRI
ADFASLYQVRTGSHGPSDLSPVCMAAALHFDLWVPNFGVQEYMGYSEQMLEVFPHNWTFD
NVYMHPGDKPGLGIEFDEKLAAKYPYEPAYLPVARLEDGTLWNR
Download sequence
Identical sequences A0A0F6MDA2 Q0T4M4
gi|110805526|ref|YP_689046.1| 373384.SFV_1563 WP_005105455.1.41372 WP_005105455.1.67802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]