SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 373384.SFV_4031 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  373384.SFV_4031
Domain Number 1 Region: 98-388
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.72e-77
Family D-glucarate dehydratase-like 0.00018
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.39e-32
Family Enolase N-terminal domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 373384.SFV_4031
Sequence length 404
Comment (Shigella flexneri 5 8401)
Sequence
MKIIAADVFVTCPGRNFVTLKITTESGLCGLGDATLNGRELSVASYLKDHLCPQLIGRDA
SRIEDIWQFFYKGAYWRRGPVTMSAISAIDMALWDIKAKAANMPLYQLLGGASREGVMVY
CHTTGRTIDEVLEDYAKHQQMGFKAIRVQCGVPGMQTTYGLAKGKGLAYEPATKGLWPEE
QLWSSEKYLDFTPKSFEAVRNKFGFNEHLLHDMHHRLTPIEAARFGKSIEDYRLFWMEDP
TPAENQECFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIGYIRTTITHAGGITGMRRI
ADFASLYQVRTGSHGPSDLSPVCHAAALHFDLWVPNFGVQEYMGYSEQMLEVFPYSWRFE
EGYMHPGDEPGLGISFDEKLAAKYPYDPEYLPVARLEDGTLLNW
Download sequence
Identical sequences A0A0F6MJQ4 Q0SY32
WP_000690940.1.41372 WP_000690940.1.67802 gi|110807818|ref|YP_691338.1| 373384.SFV_4031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]