SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 373903.Hore_11700 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  373903.Hore_11700
Domain Number - Region: 327-414
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0149
Family Voltage-gated potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 373903.Hore_11700
Sequence length 441
Comment (Halothermothrix orenii H 168)
Sequence
MISIFKNLSPGQILVIGYSTVILVGTILLLLPVSTVEGQTTNFLEALFTATSATAVTGLI
VVNTAEHWTGFGQTVIMLLIQVGGLGFMTTTTLLFLILRRKVLLQERLIVMEEINYNKLS
GVIRLTRYIILLTFITEITGTLLLYLYFKGLMPDNRAWFYALFHSISAFNNAGFDLFGNS
LENFTGSLYINLIITFLFIFGGLGFLVISEIYNKRQYKKLSLHSKMVISMTLFLIISGTL
ALFILEFNNPATLGNYTPGIKLLASYFQAVTPRTAGFNTIPINQFRDVSLFIMIVLMFIG
ASPGSTGGGVKTTTAGTLLVVVYNMARGKEDIEIFRRRIKKKDIYKTLSVVVISLLIIVV
VTIVLSITEEFAFIQIVFEVFSAFGTVGLTTGITPQLSNTGRLFIIITMFIGRVGPFTIA
MALGRKRIKAIRYPQEDILIG
Download sequence
Identical sequences B8CXA1
373903.Hore_11700 WP_012636105.1.20074 gi|220932007|ref|YP_002508915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]