SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 374847.Kcr_1606 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  374847.Kcr_1606
Domain Number 1 Region: 140-418
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.9e-107
Family Enolase 0.00000037
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.43e-46
Family Enolase N-terminal domain-like 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 374847.Kcr_1606
Sequence length 421
Comment (Candidatus Korarchaeum cryptofilum OPF8)
Sequence
MSFRIEDVRAREVLDSRGNPTVEVTVKLEGGGSGRFSVPSGASKGKREALELRDGGKWLR
GMGVIKAVRNVNEIIRPSLIGVDASIQPLVDDILIQLDGTPNKSRLGANSILGASVASAK
ASSDQMGVPLYKYLGGAFSRVLPIPLMNIINGGKHAGNELAIQEFMIVPVKFKTFKDALF
AGVSVYMELKALLEERYGRHAVNLGDEGGFAPPMKRTEEALEALVSSIERVGLEGEVKLA
IDCAASNFYADGKYNIDGASLTKEELISFYERIVDEYPIVAIEDPFHEEDLDSLSELTKK
LGHRILLVGDDYFVSNERYLRKGIEAKAGNAVLLKVNQIGTLTEAVRTASLAFRYGYRVI
VSHRSGETNDPFISDFSVALNCGYIKAGAPARGERVAKYNRLLEIEEELGSVASFSQLDT
L
Download sequence
Identical sequences B1L7C2
374847.Kcr_1606 gi|170291218|ref|YP_001738034.1| WP_012310248.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]