SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 374931.CGSHiGG_09055 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  374931.CGSHiGG_09055
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.12e-17
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 374931.CGSHiGG_09055
Sequence length 105
Comment (Haemophilus influenzae PittGG)
Sequence
MLNWDLQKNNDKITLFLFGELSRSTLLPMWQQRGVFLSESTLDKTIVEWNLSGLQHIDSA
GFTALCDFLRECQKINKTVRLVYPPKQLLTLADLVGLSDWIANFT
Download sequence
Identical sequences A0A0D0H0M7 A0A0E1SWQ5 A0A0E1WM87 A0A110K8E8 A4N220 A4NWJ9 A5UIK9 E1X6Q5 E7A5H7 Q4QLK5
281310.NTHI1246 374930.CGSHiEE_06650 374931.CGSHiGG_09055 gi|148826303|ref|YP_001291056.1| WP_005651726.1.101347 WP_005651726.1.1036 WP_005651726.1.10621 WP_005651726.1.12329 WP_005651726.1.12713 WP_005651726.1.13610 WP_005651726.1.15261 WP_005651726.1.17428 WP_005651726.1.20018 WP_005651726.1.23065 WP_005651726.1.23149 WP_005651726.1.23920 WP_005651726.1.25413 WP_005651726.1.26667 WP_005651726.1.27712 WP_005651726.1.28397 WP_005651726.1.32414 WP_005651726.1.32618 WP_005651726.1.32982 WP_005651726.1.34722 WP_005651726.1.34925 WP_005651726.1.37003 WP_005651726.1.3733 WP_005651726.1.37452 WP_005651726.1.38938 WP_005651726.1.39279 WP_005651726.1.39974 WP_005651726.1.40038 WP_005651726.1.40040 WP_005651726.1.40343 WP_005651726.1.40503 WP_005651726.1.40942 WP_005651726.1.42240 WP_005651726.1.42267 WP_005651726.1.42821 WP_005651726.1.43923 WP_005651726.1.45125 WP_005651726.1.50588 WP_005651726.1.50795 WP_005651726.1.51509 WP_005651726.1.53947 WP_005651726.1.55069 WP_005651726.1.56005 WP_005651726.1.56181 WP_005651726.1.57183 WP_005651726.1.57312 WP_005651726.1.6054 WP_005651726.1.61426 WP_005651726.1.62109 WP_005651726.1.62697 WP_005651726.1.63263 WP_005651726.1.68713 WP_005651726.1.71424 WP_005651726.1.74240 WP_005651726.1.74810 WP_005651726.1.75193 WP_005651726.1.76422 WP_005651726.1.76737 WP_005651726.1.78014 WP_005651726.1.82376 WP_005651726.1.85244 WP_005651726.1.85362 WP_005651726.1.8638 WP_005651726.1.86544 WP_005651726.1.86649 WP_005651726.1.87366 WP_005651726.1.87894 WP_005651726.1.8829 WP_005651726.1.88810 WP_005651726.1.90320 WP_005651726.1.91188 WP_005651726.1.91647 WP_005651726.1.91769 WP_005651726.1.92858 WP_005651726.1.93392 WP_005651726.1.93723 WP_005651726.1.94547 WP_005651726.1.94621 WP_005651726.1.9601 WP_005651726.1.96546 WP_005651726.1.9761 WP_005651726.1.98200 WP_005651726.1.99776 gi|386266210|ref|YP_005829702.1| gi|386264491|ref|YP_005827984.1| gi|68249640|ref|YP_248752.1| gi|319897437|ref|YP_004135634.1| gi|148828245|ref|YP_001292998.1| gi|378697308|ref|YP_005179266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]