SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 375286.mma_1109 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  375286.mma_1109
Domain Number 1 Region: 450-558
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.1e-17
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 375286.mma_1109
Sequence length 568
Comment (Janthinobacterium Marseille)
Sequence
MKPFKFSFHPRLIDCLRDYDGSKFFQDLTAGLTVGIVALPLAMAFAIASGVKPEAGIFTA
VIAGFLVSALGGSRVQIGGPAGAFIVIIYGIVEKYGVANLLIATVFAGVMLCAMGVFRLG
SLIRYIPVPIVIGFTSGIAVLIALSQMKDFFGLHIEKMPGDFFAQIQTLAQNFDSFNPTS
IIIGVLSLALIFGWPLLLKPKATELELPPRVATHRMRRLLRALPGTIIVLVLATLAVSLF
DLKVDTIGSKFGGIPQGVPDFALPEFSWALVQQLFAPALTIALLGAIESLLCARVADNIT
GDRHDPNQELMAQGIANVVTPFFGGIPATGTIARTVTNIRAGAVSPVSGILHALTLLFIV
LIAAPLANNIPLAALAAILLYVAYNMGDWHEFARLRHFSMNYRILMLSTFFLTVIVDLTV
AVQVGLVLACVFFIYRISSLTRIEQIPNEEMVVELPPGVHAYSIFGSLFFGAVGKLEGLI
EPKAMPERALILELHQLINLDATGLDALETIRKSLQKHGSQLILCGLNRQPRDLMRRSGF
LDRLGADHCLPNLQAAIDVSAALEGYPA
Download sequence
Identical sequences A6SX02
375286.mma_1109 gi|152980676|ref|YP_001352799.1| WP_012078966.1.39695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]