SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 375286.mma_3212 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  375286.mma_3212
Domain Number 1 Region: 264-316
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000255
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 
Domain Number 2 Region: 395-472
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000108
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 375286.mma_3212
Sequence length 475
Comment (Janthinobacterium Marseille)
Sequence
MHTRIDVGIFSLFGKKDKQPARKSTEAESSQKKRDELRVNAKSESDYVQRMAAHATAMKI
DAIESEMSSEFVKPLPFSGNTMPGPPSQFLNTNVRPPNTQTNKAPETAPQLGQPSMLPDI
MGASTAFLLGAETVIGPVAISKSEAPLVIEEAAILFANGQTDLIEPVLLNAIAEDALGST
LLTVWGMLFDLYQITGQRSQFENLSIEFANKFEMSPPTWRESNATETNQAPAARSSTIPS
VAFSAKLDAGIIKQLERIKNLAEMSPVIKLEFARVTQVDPVGCGLLLNILKRLQKSGHKL
ILVGAPELAEKIQAILQVGRRDETEAPWLLLLEVLRLLNREADFEERSIDYCVTFEVSPP
AFVSPQDKVTTDNEESAPPDEAATDHFMMPVLIDARSDSLSQNIAAYAHTHNPVVLDCTQ
LTRMDFNAAGRLFGDMMPLIASGKSIELHNPNHFIVALCNVMGMTDSVRIVPRKN
Download sequence
Identical sequences A6T305
WP_012081055.1.39695 375286.mma_3212 gi|152982801|ref|YP_001354902.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]