SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 375451.RD1_2151 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  375451.RD1_2151
Domain Number 1 Region: 430-514
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000255
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 375451.RD1_2151
Sequence length 542
Comment (Roseobacter denitrificans OCh 114)
Sequence
MARASFRTFAKNLDVTDLRWMPDKGFSPARLRIELLSGLTVALALVPEAVAFAFVAGVHP
LVGLYAAFIVGLITALIGGRPGMISGATGALAVVMVALVAEHGVEYLFATVVLMGFLQVF
AGVMQWGKFIRLVPHPVMLGFVNGLAIVIFLAQLSQFKVPGTLENTGHGMGGGEWLSGQP
LALMLLLVAATMAIIWVMPRITRAIPAPLAGIGIVAAVVIFFGLDVPRVGDLASIQGGLP
SLHIPMVPLNWETLEIILPYAIILAAIGLIESLLTLNLVGDMTGKRGGASQECIAQGLAN
TVTGFFGGMGGCAMIGQSMINVKSGGRTRVAGIAAAVFLLLFILVGSSVIELIPLAALVG
VMFMVVIGTFAWNSLTILRKVPLTDAFVILLVTVVTVMEDLAVAVVVGVIVSALAYAWNN
ARRIHAKAYTTPEGARVYQVQGPLFFGSSDGFTELFDVEGDPSEVIVDFADSRVVDQSAL
QAIEAIAGKYEAQGKRIQLRHLSPDCHRLLNKAGHLMVDSDDDPDYALAVNYSVRTGVLG
GH
Download sequence
Identical sequences Q167U7
375451.RD1_2151 gi|110679425|ref|YP_682432.1| WP_011568363.1.1045 WP_011568363.1.29122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]