SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 377628.YPN_1005 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  377628.YPN_1005
Domain Number 1 Region: 90-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000288
Family NfeD domain-like 0.0092
Further Details:      
 
Weak hits

Sequence:  377628.YPN_1005
Domain Number - Region: 28-103
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00654
Family LacY-like proton/sugar symporter 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 377628.YPN_1005
Sequence length 149
Comment (Yersinia pestis Nepal516)
Sequence
MLEEIAVNPNWFWLSLGGLLLAAEMLGASGYLLWSGIAAVLVGVLVWLFPFSWEMQGVLF
SILTVVSAFLWWYWLSKRTKPQPAMLNQRNHQLLGIRATLTEPTVDGYGRMKVGDSSWRI
YCATELNPGTEVEVILVEGNTLHVRAVNR
Download sequence
Identical sequences A0A0E1NTU0 A0A0H2W2F1 A0A0H2YGV4 A0A0H3B5M7 A0A0M1VD57 A0A0U1ENI8 A0A0U1R1B2 A0A208SAZ2 A0A2A7VP89 Q66DM0 Q7CJZ7
gi|384123296|ref|YP_005505916.1| gi|384139069|ref|YP_005521771.1| gi|145599983|ref|YP_001164059.1| gi|153950019|ref|YP_001401985.1| 187410.y1095 214092.YPO3084 229193.YP_0840 273123.YPTB1024 349746.YpAngola_A1267 349747.YpsIP31758_3025 360102.YPA_2579 377628.YPN_1005 386656.YPDSF_2722 502800.YPK_3163 gi|384127150|ref|YP_005509764.1| WP_002208577.1.100083 WP_002208577.1.100246 WP_002208577.1.100593 WP_002208577.1.10066 WP_002208577.1.100921 WP_002208577.1.100931 WP_002208577.1.10105 WP_002208577.1.101305 WP_002208577.1.101382 WP_002208577.1.101928 WP_002208577.1.102012 WP_002208577.1.102067 WP_002208577.1.10736 WP_002208577.1.10935 WP_002208577.1.10955 WP_002208577.1.11693 WP_002208577.1.12167 WP_002208577.1.12463 WP_002208577.1.12736 WP_002208577.1.12857 WP_002208577.1.1388 WP_002208577.1.14063 WP_002208577.1.14169 WP_002208577.1.14804 WP_002208577.1.15321 WP_002208577.1.15555 WP_002208577.1.15605 WP_002208577.1.15689 WP_002208577.1.16243 WP_002208577.1.16333 WP_002208577.1.17135 WP_002208577.1.17141 WP_002208577.1.17608 WP_002208577.1.17873 WP_002208577.1.17983 WP_002208577.1.18208 WP_002208577.1.18640 WP_002208577.1.18826 WP_002208577.1.19329 WP_002208577.1.19425 WP_002208577.1.19739 WP_002208577.1.19763 WP_002208577.1.20035 WP_002208577.1.20380 WP_002208577.1.20547 WP_002208577.1.2064 WP_002208577.1.20932 WP_002208577.1.21486 WP_002208577.1.21784 WP_002208577.1.21879 WP_002208577.1.21934 WP_002208577.1.22530 WP_002208577.1.22542 WP_002208577.1.22708 WP_002208577.1.23157 WP_002208577.1.23271 WP_002208577.1.23687 WP_002208577.1.23811 WP_002208577.1.24002 WP_002208577.1.2451 WP_002208577.1.24517 WP_002208577.1.25181 WP_002208577.1.25394 WP_002208577.1.26383 WP_002208577.1.2640 WP_002208577.1.26776 WP_002208577.1.26960 WP_002208577.1.27124 WP_002208577.1.27251 WP_002208577.1.2726 WP_002208577.1.28647 WP_002208577.1.28922 WP_002208577.1.29157 WP_002208577.1.29186 WP_002208577.1.29355 WP_002208577.1.2947 WP_002208577.1.29622 WP_002208577.1.2964 WP_002208577.1.29685 WP_002208577.1.29814 WP_002208577.1.3092 WP_002208577.1.30931 WP_002208577.1.311 WP_002208577.1.31336 WP_002208577.1.31496 WP_002208577.1.31721 WP_002208577.1.31739 WP_002208577.1.31805 WP_002208577.1.32343 WP_002208577.1.32388 WP_002208577.1.32446 WP_002208577.1.32736 WP_002208577.1.33203 WP_002208577.1.33661 WP_002208577.1.33775 WP_002208577.1.33937 WP_002208577.1.34031 WP_002208577.1.34138 WP_002208577.1.35389 WP_002208577.1.35538 WP_002208577.1.36088 WP_002208577.1.37174 WP_002208577.1.37494 WP_002208577.1.37863 WP_002208577.1.38147 WP_002208577.1.38235 WP_002208577.1.38532 WP_002208577.1.38743 WP_002208577.1.38824 WP_002208577.1.38993 WP_002208577.1.39066 WP_002208577.1.39346 WP_002208577.1.3976 WP_002208577.1.39858 WP_002208577.1.40071 WP_002208577.1.40134 WP_002208577.1.40534 WP_002208577.1.40853 WP_002208577.1.41196 WP_002208577.1.4210 WP_002208577.1.42361 WP_002208577.1.42490 WP_002208577.1.42976 WP_002208577.1.44408 WP_002208577.1.44598 WP_002208577.1.44603 WP_002208577.1.44832 WP_002208577.1.45214 WP_002208577.1.46262 WP_002208577.1.46545 WP_002208577.1.46686 WP_002208577.1.46697 WP_002208577.1.46731 WP_002208577.1.4678 WP_002208577.1.46891 WP_002208577.1.47387 WP_002208577.1.47440 WP_002208577.1.47881 WP_002208577.1.48166 WP_002208577.1.48722 WP_002208577.1.4889 WP_002208577.1.49315 WP_002208577.1.49906 WP_002208577.1.4997 WP_002208577.1.50010 WP_002208577.1.50093 WP_002208577.1.50106 WP_002208577.1.50185 WP_002208577.1.50984 WP_002208577.1.51284 WP_002208577.1.51293 WP_002208577.1.51588 WP_002208577.1.51772 WP_002208577.1.51934 WP_002208577.1.52158 WP_002208577.1.52247 WP_002208577.1.52473 WP_002208577.1.52734 WP_002208577.1.52792 WP_002208577.1.52819 WP_002208577.1.52969 WP_002208577.1.53147 WP_002208577.1.53300 WP_002208577.1.53838 WP_002208577.1.53848 WP_002208577.1.53883 WP_002208577.1.53953 WP_002208577.1.54568 WP_002208577.1.54951 WP_002208577.1.55194 WP_002208577.1.55695 WP_002208577.1.5592 WP_002208577.1.56031 WP_002208577.1.56912 WP_002208577.1.56953 WP_002208577.1.57585 WP_002208577.1.57657 WP_002208577.1.58067 WP_002208577.1.58543 WP_002208577.1.58794 WP_002208577.1.59102 WP_002208577.1.59431 WP_002208577.1.5957 WP_002208577.1.59635 WP_002208577.1.5968 WP_002208577.1.59687 WP_002208577.1.59789 WP_002208577.1.59885 WP_002208577.1.60437 WP_002208577.1.60707 WP_002208577.1.60896 WP_002208577.1.61689 WP_002208577.1.62232 WP_002208577.1.62342 WP_002208577.1.6270 WP_002208577.1.6333 WP_002208577.1.63387 WP_002208577.1.63641 WP_002208577.1.64142 WP_002208577.1.64474 WP_002208577.1.64780 WP_002208577.1.64786 WP_002208577.1.64910 WP_002208577.1.653 WP_002208577.1.65400 WP_002208577.1.65554 WP_002208577.1.6570 WP_002208577.1.65706 WP_002208577.1.65718 WP_002208577.1.6581 WP_002208577.1.66118 WP_002208577.1.66546 WP_002208577.1.66616 WP_002208577.1.67404 WP_002208577.1.67850 WP_002208577.1.6791 WP_002208577.1.68361 WP_002208577.1.68371 WP_002208577.1.68753 WP_002208577.1.68855 WP_002208577.1.69018 WP_002208577.1.69316 WP_002208577.1.69951 WP_002208577.1.70117 WP_002208577.1.70171 WP_002208577.1.70319 WP_002208577.1.70377 WP_002208577.1.70417 WP_002208577.1.70726 WP_002208577.1.7083 WP_002208577.1.7169 WP_002208577.1.71744 WP_002208577.1.72280 WP_002208577.1.72440 WP_002208577.1.72486 WP_002208577.1.7402 WP_002208577.1.74131 WP_002208577.1.74310 WP_002208577.1.74577 WP_002208577.1.74738 WP_002208577.1.75169 WP_002208577.1.75173 WP_002208577.1.7518 WP_002208577.1.75337 WP_002208577.1.75407 WP_002208577.1.75636 WP_002208577.1.75821 WP_002208577.1.76555 WP_002208577.1.76670 WP_002208577.1.77295 WP_002208577.1.77387 WP_002208577.1.77429 WP_002208577.1.77569 WP_002208577.1.77691 WP_002208577.1.78004 WP_002208577.1.7841 WP_002208577.1.78556 WP_002208577.1.79515 WP_002208577.1.79609 WP_002208577.1.79825 WP_002208577.1.79981 WP_002208577.1.8009 WP_002208577.1.80331 WP_002208577.1.81848 WP_002208577.1.81877 WP_002208577.1.8210 WP_002208577.1.82133 WP_002208577.1.82151 WP_002208577.1.82270 WP_002208577.1.82436 WP_002208577.1.82619 WP_002208577.1.8303 WP_002208577.1.83039 WP_002208577.1.83265 WP_002208577.1.83630 WP_002208577.1.8420 WP_002208577.1.84703 WP_002208577.1.84720 WP_002208577.1.85269 WP_002208577.1.85270 WP_002208577.1.8559 WP_002208577.1.85802 WP_002208577.1.86034 WP_002208577.1.86059 WP_002208577.1.86413 WP_002208577.1.87107 WP_002208577.1.8728 WP_002208577.1.87418 WP_002208577.1.8762 WP_002208577.1.87853 WP_002208577.1.87988 WP_002208577.1.88362 WP_002208577.1.88472 WP_002208577.1.89359 WP_002208577.1.89542 WP_002208577.1.8964 WP_002208577.1.90176 WP_002208577.1.9051 WP_002208577.1.90624 WP_002208577.1.91373 WP_002208577.1.91844 WP_002208577.1.92030 WP_002208577.1.92331 WP_002208577.1.92604 WP_002208577.1.927 WP_002208577.1.9311 WP_002208577.1.9320 WP_002208577.1.93623 WP_002208577.1.93928 WP_002208577.1.93933 WP_002208577.1.94052 WP_002208577.1.94201 WP_002208577.1.94545 WP_002208577.1.94683 WP_002208577.1.95746 WP_002208577.1.95981 WP_002208577.1.97245 WP_002208577.1.97375 WP_002208577.1.97448 WP_002208577.1.97791 WP_002208577.1.97864 WP_002208577.1.97872 WP_002208577.1.97894 WP_002208577.1.99109 WP_002208577.1.99383 WP_002208577.1.9941 WP_002208577.1.99416 WP_002208577.1.99788 WP_002208577.1.99882 WP_002208577.1.99972 WP_002208577.1.99990 YP_002348004.1.25044 gi|51595373|ref|YP_069564.1| gi|170025382|ref|YP_001721887.1| gi|218930129|ref|YP_002348004.1| gi|22124999|ref|NP_668422.1| gi|108811170|ref|YP_646937.1| gi|108808571|ref|YP_652487.1| gi|294504828|ref|YP_003568890.1| gi|384415773|ref|YP_005625135.1| gi|162420816|ref|YP_001605802.1| gi|45440683|ref|NP_992222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]