SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 377628.YPN_1259 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  377628.YPN_1259
Domain Number 1 Region: 266-332
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000000016
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.008
Further Details:      
 
Domain Number 2 Region: 23-139
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.000000000742
Family D-glucarate dehydratase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 377628.YPN_1259
Sequence length 375
Comment (Yersinia pestis Nepal516)
Sequence
MHNGSPIIRRKSTRIYVGKVPIGDGAPIAVQSMTNTKTTDVDATVAQIKALERVGVDIVR
VSIPTMDAAEAFKLIKQQSTVPLVADIHFDYRIALKVAEYGVDCLRINPGNIGNESRIRE
VVACARDYNIPIRIGINGGSLEKDIQEKYGEPTPEALLESAMRHVDILDRLNFDQFKVSV
KASDVFLAVNSYRLLAKQINNPLHLGITEAGGARSGSVKSAIGLGLLLSEGIGDTLRISL
AADPVEEVKVGFDILKSLRIRARGINFIACPTCSRQEFDVIGTVNALEQRLEDLITPMDV
SIIGCVVNGPGEALVSTIGVTGARNHSGFYEDGVRQKERFDNKAMIDQLEAKIRAKASIL
DANNRIVINQLDDNK
Download sequence
Identical sequences A0A0E1NN05 A0A0E8XED4 A0A0M1VA88 A0A0T9J2L1 A0A0U1EM09 A0A154S9S0 A0A208S0X1 A7FFY9 A9R802 B1JS05 B2K9Q0 P58672 Q1C5I8 Q1CK91 Q667Z9
gi|45442517|ref|NP_994056.1| gi|108808313|ref|YP_652229.1| gi|170023539|ref|YP_001720044.1| IDP90683 gi|22125252|ref|NP_668675.1| gi|218929939|ref|YP_002347814.1| 187410.y1353 214092.YPO2879 229193.YP_2745 273123.YPTB2841 349746.YpAngola_A0418 349747.YpsIP31758_1186 360102.YPA_2319 377628.YPN_1259 502800.YPK_1293 502801.YPTS_2950 gi|384122850|ref|YP_005505470.1| gi|294504559|ref|YP_003568621.1| gi|108811422|ref|YP_647189.1| gi|186896252|ref|YP_001873364.1| gi|384126883|ref|YP_005509497.1| WP_002209817.1.100083 WP_002209817.1.100246 WP_002209817.1.100593 WP_002209817.1.10066 WP_002209817.1.100921 WP_002209817.1.100931 WP_002209817.1.10105 WP_002209817.1.101305 WP_002209817.1.101382 WP_002209817.1.101928 WP_002209817.1.102012 WP_002209817.1.102067 WP_002209817.1.10736 WP_002209817.1.10935 WP_002209817.1.10955 WP_002209817.1.11693 WP_002209817.1.12167 WP_002209817.1.12463 WP_002209817.1.12736 WP_002209817.1.12857 WP_002209817.1.1388 WP_002209817.1.14063 WP_002209817.1.14169 WP_002209817.1.14804 WP_002209817.1.15321 WP_002209817.1.15555 WP_002209817.1.15605 WP_002209817.1.15689 WP_002209817.1.16243 WP_002209817.1.16333 WP_002209817.1.17135 WP_002209817.1.17141 WP_002209817.1.17873 WP_002209817.1.17983 WP_002209817.1.18208 WP_002209817.1.18640 WP_002209817.1.18826 WP_002209817.1.19329 WP_002209817.1.19425 WP_002209817.1.19739 WP_002209817.1.19763 WP_002209817.1.20035 WP_002209817.1.20380 WP_002209817.1.20547 WP_002209817.1.2064 WP_002209817.1.20932 WP_002209817.1.21486 WP_002209817.1.21784 WP_002209817.1.21879 WP_002209817.1.21934 WP_002209817.1.22530 WP_002209817.1.22542 WP_002209817.1.22708 WP_002209817.1.23157 WP_002209817.1.23271 WP_002209817.1.23811 WP_002209817.1.24002 WP_002209817.1.2451 WP_002209817.1.24517 WP_002209817.1.25394 WP_002209817.1.26383 WP_002209817.1.2640 WP_002209817.1.26509 WP_002209817.1.26776 WP_002209817.1.26960 WP_002209817.1.27124 WP_002209817.1.27251 WP_002209817.1.2726 WP_002209817.1.28647 WP_002209817.1.28922 WP_002209817.1.29157 WP_002209817.1.29186 WP_002209817.1.29355 WP_002209817.1.2947 WP_002209817.1.2964 WP_002209817.1.29814 WP_002209817.1.3092 WP_002209817.1.30931 WP_002209817.1.311 WP_002209817.1.31336 WP_002209817.1.31496 WP_002209817.1.31721 WP_002209817.1.31739 WP_002209817.1.31805 WP_002209817.1.32343 WP_002209817.1.32388 WP_002209817.1.32446 WP_002209817.1.32736 WP_002209817.1.33203 WP_002209817.1.33324 WP_002209817.1.33661 WP_002209817.1.33775 WP_002209817.1.33937 WP_002209817.1.34031 WP_002209817.1.34138 WP_002209817.1.35389 WP_002209817.1.35538 WP_002209817.1.36088 WP_002209817.1.37174 WP_002209817.1.37863 WP_002209817.1.38147 WP_002209817.1.38235 WP_002209817.1.38532 WP_002209817.1.38743 WP_002209817.1.38824 WP_002209817.1.39066 WP_002209817.1.39346 WP_002209817.1.3976 WP_002209817.1.39858 WP_002209817.1.40071 WP_002209817.1.40134 WP_002209817.1.40534 WP_002209817.1.40853 WP_002209817.1.41196 WP_002209817.1.41984 WP_002209817.1.4210 WP_002209817.1.42361 WP_002209817.1.42490 WP_002209817.1.42976 WP_002209817.1.44408 WP_002209817.1.44598 WP_002209817.1.44832 WP_002209817.1.45198 WP_002209817.1.45214 WP_002209817.1.46262 WP_002209817.1.46545 WP_002209817.1.46686 WP_002209817.1.46697 WP_002209817.1.4678 WP_002209817.1.46891 WP_002209817.1.47387 WP_002209817.1.47440 WP_002209817.1.47769 WP_002209817.1.47881 WP_002209817.1.48166 WP_002209817.1.48722 WP_002209817.1.4889 WP_002209817.1.49315 WP_002209817.1.49906 WP_002209817.1.4997 WP_002209817.1.50010 WP_002209817.1.50093 WP_002209817.1.50106 WP_002209817.1.50185 WP_002209817.1.50984 WP_002209817.1.51284 WP_002209817.1.51293 WP_002209817.1.51588 WP_002209817.1.51772 WP_002209817.1.51934 WP_002209817.1.52158 WP_002209817.1.52247 WP_002209817.1.52473 WP_002209817.1.52569 WP_002209817.1.52734 WP_002209817.1.52792 WP_002209817.1.52819 WP_002209817.1.52969 WP_002209817.1.53147 WP_002209817.1.53300 WP_002209817.1.53838 WP_002209817.1.53848 WP_002209817.1.53883 WP_002209817.1.53953 WP_002209817.1.54568 WP_002209817.1.54951 WP_002209817.1.55194 WP_002209817.1.55695 WP_002209817.1.5592 WP_002209817.1.56031 WP_002209817.1.56912 WP_002209817.1.56953 WP_002209817.1.57585 WP_002209817.1.57657 WP_002209817.1.58067 WP_002209817.1.58543 WP_002209817.1.58794 WP_002209817.1.59102 WP_002209817.1.59431 WP_002209817.1.5957 WP_002209817.1.59635 WP_002209817.1.5968 WP_002209817.1.59687 WP_002209817.1.59789 WP_002209817.1.59885 WP_002209817.1.60437 WP_002209817.1.60707 WP_002209817.1.60896 WP_002209817.1.61689 WP_002209817.1.62232 WP_002209817.1.62342 WP_002209817.1.6270 WP_002209817.1.6333 WP_002209817.1.63387 WP_002209817.1.63517 WP_002209817.1.63641 WP_002209817.1.64142 WP_002209817.1.64474 WP_002209817.1.64780 WP_002209817.1.64786 WP_002209817.1.64910 WP_002209817.1.653 WP_002209817.1.65400 WP_002209817.1.65554 WP_002209817.1.6570 WP_002209817.1.65706 WP_002209817.1.65718 WP_002209817.1.6581 WP_002209817.1.66118 WP_002209817.1.66546 WP_002209817.1.66616 WP_002209817.1.67404 WP_002209817.1.67850 WP_002209817.1.6791 WP_002209817.1.68361 WP_002209817.1.68371 WP_002209817.1.68753 WP_002209817.1.68855 WP_002209817.1.69018 WP_002209817.1.69316 WP_002209817.1.69951 WP_002209817.1.70117 WP_002209817.1.70171 WP_002209817.1.70319 WP_002209817.1.70377 WP_002209817.1.70417 WP_002209817.1.70726 WP_002209817.1.7083 WP_002209817.1.7169 WP_002209817.1.71744 WP_002209817.1.72280 WP_002209817.1.72440 WP_002209817.1.72486 WP_002209817.1.7402 WP_002209817.1.74131 WP_002209817.1.74310 WP_002209817.1.74577 WP_002209817.1.74738 WP_002209817.1.75169 WP_002209817.1.75173 WP_002209817.1.7518 WP_002209817.1.75208 WP_002209817.1.75337 WP_002209817.1.75407 WP_002209817.1.75636 WP_002209817.1.75689 WP_002209817.1.75821 WP_002209817.1.76555 WP_002209817.1.76670 WP_002209817.1.77295 WP_002209817.1.77387 WP_002209817.1.77429 WP_002209817.1.77569 WP_002209817.1.77691 WP_002209817.1.78004 WP_002209817.1.7841 WP_002209817.1.78556 WP_002209817.1.7939 WP_002209817.1.79515 WP_002209817.1.79550 WP_002209817.1.79609 WP_002209817.1.79825 WP_002209817.1.79981 WP_002209817.1.8009 WP_002209817.1.80331 WP_002209817.1.81848 WP_002209817.1.81877 WP_002209817.1.8210 WP_002209817.1.82133 WP_002209817.1.82151 WP_002209817.1.82270 WP_002209817.1.82436 WP_002209817.1.82619 WP_002209817.1.8303 WP_002209817.1.83039 WP_002209817.1.83265 WP_002209817.1.83630 WP_002209817.1.8420 WP_002209817.1.84703 WP_002209817.1.84720 WP_002209817.1.85269 WP_002209817.1.85270 WP_002209817.1.8559 WP_002209817.1.85802 WP_002209817.1.86034 WP_002209817.1.86059 WP_002209817.1.86413 WP_002209817.1.87107 WP_002209817.1.8728 WP_002209817.1.87418 WP_002209817.1.8762 WP_002209817.1.87853 WP_002209817.1.87988 WP_002209817.1.88362 WP_002209817.1.88472 WP_002209817.1.89359 WP_002209817.1.89542 WP_002209817.1.8964 WP_002209817.1.90176 WP_002209817.1.9051 WP_002209817.1.90624 WP_002209817.1.91263 WP_002209817.1.91373 WP_002209817.1.91844 WP_002209817.1.92030 WP_002209817.1.92331 WP_002209817.1.92604 WP_002209817.1.927 WP_002209817.1.9311 WP_002209817.1.9320 WP_002209817.1.93623 WP_002209817.1.93928 WP_002209817.1.93933 WP_002209817.1.94052 WP_002209817.1.94201 WP_002209817.1.94545 WP_002209817.1.94683 WP_002209817.1.95746 WP_002209817.1.95981 WP_002209817.1.97245 WP_002209817.1.97375 WP_002209817.1.97448 WP_002209817.1.97791 WP_002209817.1.97864 WP_002209817.1.97872 WP_002209817.1.97894 WP_002209817.1.99109 WP_002209817.1.99383 WP_002209817.1.9941 WP_002209817.1.99416 WP_002209817.1.99788 WP_002209817.1.99882 WP_002209817.1.99972 WP_002209817.1.99990 YP_002347814.1.25044 gi|51597157|ref|YP_071348.1| gi|153950353|ref|YP_001400167.1| gi|384415512|ref|YP_005624874.1| gi|162421034|ref|YP_001605024.1| gi|384139294|ref|YP_005521996.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]