SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 377628.YPN_1666 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  377628.YPN_1666
Domain Number 1 Region: 72-164
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000471
Family Anti-sigma factor antagonist SpoIIaa 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 377628.YPN_1666
Sequence length 206
Comment (Yersinia pestis Nepal516)
Sequence
MWQLRKRNTQAFYLAIFTFVSVVLVGVISGIGLAVLLGLLQFLRTVFRPTEQLLGVNADG
MIHSMGNGNGIKAVPGVMIYRFNSPLTYFNVAYFKRRILNLVDSTPHPADWVVIDAVASF
TYADISVLAAIDELKRDLKQRNIKLILAGRRTELTRWFRINRLKSHDDDLVLVPDLYLAL
KLIQSKRRVAEKQEHESETGLEPEIG
Download sequence
Identical sequences A0A0E1NV21 A0A0H2YGR5 A0A154RU55 A0A208SC86
gi|384125784|ref|YP_005508398.1| gi|384122523|ref|YP_005505143.1| 360102.YPA_1557 377628.YPN_1666 gi|384139972|ref|YP_005522674.1| gi|108807552|ref|YP_651468.1| gi|108811828|ref|YP_647595.1| WP_002215979.1.100083 WP_002215979.1.100246 WP_002215979.1.100921 WP_002215979.1.100931 WP_002215979.1.10105 WP_002215979.1.101305 WP_002215979.1.101382 WP_002215979.1.101928 WP_002215979.1.102012 WP_002215979.1.102067 WP_002215979.1.10736 WP_002215979.1.10935 WP_002215979.1.10955 WP_002215979.1.11693 WP_002215979.1.12463 WP_002215979.1.12736 WP_002215979.1.12857 WP_002215979.1.14063 WP_002215979.1.14804 WP_002215979.1.15321 WP_002215979.1.15555 WP_002215979.1.15605 WP_002215979.1.15689 WP_002215979.1.16333 WP_002215979.1.17135 WP_002215979.1.17141 WP_002215979.1.17873 WP_002215979.1.17983 WP_002215979.1.18208 WP_002215979.1.18640 WP_002215979.1.18826 WP_002215979.1.19329 WP_002215979.1.19739 WP_002215979.1.19763 WP_002215979.1.20035 WP_002215979.1.2064 WP_002215979.1.21486 WP_002215979.1.21784 WP_002215979.1.21879 WP_002215979.1.21934 WP_002215979.1.22530 WP_002215979.1.22542 WP_002215979.1.22708 WP_002215979.1.23157 WP_002215979.1.23271 WP_002215979.1.23811 WP_002215979.1.24002 WP_002215979.1.2451 WP_002215979.1.25394 WP_002215979.1.2640 WP_002215979.1.26776 WP_002215979.1.26960 WP_002215979.1.27124 WP_002215979.1.27251 WP_002215979.1.2726 WP_002215979.1.28647 WP_002215979.1.28922 WP_002215979.1.29157 WP_002215979.1.29355 WP_002215979.1.2947 WP_002215979.1.2964 WP_002215979.1.30931 WP_002215979.1.311 WP_002215979.1.31336 WP_002215979.1.31496 WP_002215979.1.31739 WP_002215979.1.31805 WP_002215979.1.32343 WP_002215979.1.32388 WP_002215979.1.32446 WP_002215979.1.33203 WP_002215979.1.33937 WP_002215979.1.34031 WP_002215979.1.34138 WP_002215979.1.35389 WP_002215979.1.35538 WP_002215979.1.36088 WP_002215979.1.37174 WP_002215979.1.37863 WP_002215979.1.38235 WP_002215979.1.38743 WP_002215979.1.39066 WP_002215979.1.39346 WP_002215979.1.40071 WP_002215979.1.40134 WP_002215979.1.40534 WP_002215979.1.40853 WP_002215979.1.41196 WP_002215979.1.4210 WP_002215979.1.42490 WP_002215979.1.44598 WP_002215979.1.44832 WP_002215979.1.45198 WP_002215979.1.45214 WP_002215979.1.46262 WP_002215979.1.46545 WP_002215979.1.46686 WP_002215979.1.4678 WP_002215979.1.46891 WP_002215979.1.47387 WP_002215979.1.47440 WP_002215979.1.48166 WP_002215979.1.48722 WP_002215979.1.4889 WP_002215979.1.49906 WP_002215979.1.4997 WP_002215979.1.50010 WP_002215979.1.50093 WP_002215979.1.50106 WP_002215979.1.50984 WP_002215979.1.51284 WP_002215979.1.51293 WP_002215979.1.51588 WP_002215979.1.51772 WP_002215979.1.51934 WP_002215979.1.52158 WP_002215979.1.52247 WP_002215979.1.52734 WP_002215979.1.52819 WP_002215979.1.52969 WP_002215979.1.53300 WP_002215979.1.53838 WP_002215979.1.53848 WP_002215979.1.53953 WP_002215979.1.54568 WP_002215979.1.54951 WP_002215979.1.55194 WP_002215979.1.55695 WP_002215979.1.5592 WP_002215979.1.56031 WP_002215979.1.56912 WP_002215979.1.56953 WP_002215979.1.57585 WP_002215979.1.57657 WP_002215979.1.58067 WP_002215979.1.58794 WP_002215979.1.59102 WP_002215979.1.59431 WP_002215979.1.5957 WP_002215979.1.59635 WP_002215979.1.59687 WP_002215979.1.59789 WP_002215979.1.59885 WP_002215979.1.60437 WP_002215979.1.61689 WP_002215979.1.62232 WP_002215979.1.62342 WP_002215979.1.63387 WP_002215979.1.64142 WP_002215979.1.64474 WP_002215979.1.64780 WP_002215979.1.64786 WP_002215979.1.64910 WP_002215979.1.653 WP_002215979.1.65400 WP_002215979.1.65554 WP_002215979.1.6570 WP_002215979.1.65706 WP_002215979.1.65718 WP_002215979.1.6581 WP_002215979.1.66118 WP_002215979.1.66546 WP_002215979.1.66616 WP_002215979.1.67404 WP_002215979.1.67850 WP_002215979.1.68361 WP_002215979.1.68753 WP_002215979.1.68855 WP_002215979.1.69018 WP_002215979.1.69316 WP_002215979.1.69951 WP_002215979.1.70117 WP_002215979.1.70171 WP_002215979.1.70319 WP_002215979.1.70377 WP_002215979.1.70417 WP_002215979.1.70726 WP_002215979.1.7083 WP_002215979.1.7169 WP_002215979.1.71744 WP_002215979.1.72280 WP_002215979.1.72440 WP_002215979.1.7402 WP_002215979.1.74131 WP_002215979.1.74310 WP_002215979.1.74577 WP_002215979.1.74738 WP_002215979.1.75173 WP_002215979.1.7518 WP_002215979.1.75337 WP_002215979.1.75689 WP_002215979.1.75821 WP_002215979.1.76670 WP_002215979.1.77387 WP_002215979.1.77429 WP_002215979.1.77691 WP_002215979.1.7841 WP_002215979.1.78556 WP_002215979.1.79515 WP_002215979.1.79550 WP_002215979.1.79609 WP_002215979.1.79981 WP_002215979.1.80331 WP_002215979.1.81848 WP_002215979.1.81877 WP_002215979.1.8210 WP_002215979.1.82151 WP_002215979.1.82270 WP_002215979.1.82619 WP_002215979.1.8303 WP_002215979.1.83039 WP_002215979.1.83265 WP_002215979.1.8420 WP_002215979.1.84703 WP_002215979.1.84720 WP_002215979.1.85269 WP_002215979.1.85270 WP_002215979.1.8559 WP_002215979.1.85802 WP_002215979.1.86034 WP_002215979.1.86413 WP_002215979.1.87107 WP_002215979.1.8728 WP_002215979.1.87418 WP_002215979.1.87853 WP_002215979.1.87988 WP_002215979.1.88362 WP_002215979.1.88472 WP_002215979.1.89359 WP_002215979.1.8964 WP_002215979.1.90176 WP_002215979.1.9051 WP_002215979.1.91373 WP_002215979.1.91844 WP_002215979.1.92331 WP_002215979.1.92604 WP_002215979.1.927 WP_002215979.1.9311 WP_002215979.1.9320 WP_002215979.1.93928 WP_002215979.1.93933 WP_002215979.1.94052 WP_002215979.1.94201 WP_002215979.1.94545 WP_002215979.1.94683 WP_002215979.1.95746 WP_002215979.1.95981 WP_002215979.1.97245 WP_002215979.1.97375 WP_002215979.1.97448 WP_002215979.1.97791 WP_002215979.1.97864 WP_002215979.1.97872 WP_002215979.1.97894 WP_002215979.1.99109 WP_002215979.1.99383 WP_002215979.1.9941 WP_002215979.1.99416 WP_002215979.1.99788 WP_002215979.1.99990 gi|384414358|ref|YP_005623720.1| gi|294503761|ref|YP_003567823.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]