SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 377629.TERTU_1083 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  377629.TERTU_1083
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000687
Family Anti-sigma factor antagonist SpoIIaa 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 377629.TERTU_1083
Sequence length 169
Comment (Teredinibacter turnerae T7901)
Sequence
MSSGEIKVAEHNGVYVIKMEGDVRLTLCLSFDEFIEQMFDAPDFCSVVFDLSDALAIDST
TLGLMAKISIKGRALHYDDPTVVSNNPSITRLLSSMGFEDIFNIVDSTQALRQLACKPDN
PVVLDEKVCDEQSVQARVIEAHKLLMAMNAANHDTFRELVDTLENSAHH
Download sequence
Identical sequences C5BR06
gi|254785241|ref|YP_003072669.1| WP_015819746.1.31564 WP_015819746.1.38994 WP_015819746.1.4287 WP_015819746.1.78565 377629.TERTU_1083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]