SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 377629.TERTU_1893 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  377629.TERTU_1893
Domain Number 1 Region: 91-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000366
Family NfeD domain-like 0.013
Further Details:      
 
Weak hits

Sequence:  377629.TERTU_1893
Domain Number - Region: 27-76
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0068
Family LacY-like proton/sugar symporter 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 377629.TERTU_1893
Sequence length 148
Comment (Teredinibacter turnerae T7901)
Sequence
MNLSILSGPWFWVALGLALLALELLGAGGFLLAIGVASLIVAMITFFVPMGWVVEFAVFG
VLSVICTFVYWRYLKPNSTESEDPLLNNRVARLVGSRAVLIAPVVAGQGRVQIHDALWTV
ECDEPLPQGALVEITGYHGSTLTAQPVS
Download sequence
Identical sequences C5BI00
377629.TERTU_1893 gi|254785960|ref|YP_003073389.1| WP_015819749.1.31564 WP_015819749.1.38994 WP_015819749.1.4287 WP_015819749.1.78565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]