SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 378753.KRH_13730 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  378753.KRH_13730
Domain Number 1 Region: 84-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000955
Family NfeD domain-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 378753.KRH_13730
Sequence length 164
Comment (Kocuria rhizophila DC2201)
Sequence
MWDALVNNPWIFWLIIMLALAAIEMLTLDFLFLMMSIAALVTAGVSLVLDSFTVQVVLFA
VVSVLLIFLIRPLALRRLNRSTPNTRSNTERLIGLPCTVLEPVSQRSGLVRLEGDVWTAR
CAAGAELSEGADAWVHRIDGATAVVADVAPARTEPTDTGRRAHP
Download sequence
Identical sequences B2GIM7
gi|184201019|ref|YP_001855226.1| WP_012398441.1.5541 WP_012398441.1.84478 378753.KRH_13730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]