SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 379066.GAU_2344 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  379066.GAU_2344
Domain Number - Region: 464-530
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00353
Family Anti-sigma factor antagonist SpoIIaa 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 379066.GAU_2344
Sequence length 537
Comment (Gemmatimonas aurantiaca T 27)
Sequence
MPALSRAPDGVPESSVGPDSPGPVSPRGFFDEWRNDVPASVVVFLVALPLCLGVALASGA
PLLSGVVAGIVGGIVVGMASGSQLMVSGPAAGLTAIVVTGIAQVGGFAQFLPAVILGGAL
QIGLGVARAGVIGYYFPSSVIKGMLAAIGLTLILKQIPHAMGYDAGYEGDFSFVSPSGEN
TFGAIGHALQQVQPGAIAAALIGVGLMVVWPKTPMARMKLFPAPLAAVVLGVGLNQLLLA
VAPEYAIRDTHLVTLPTTGAEGVWGQLTRPDWGALANQQVWILAATIGIVASLESLLSLE
ATNKLDPEKRDAPANRELLAQGMGNVVSGFFGGLPVTGVIVRSSANVDAGARTRLSAVVH
GILLIVAVLLLARVLNLIPLSALAAVLLVTGFKLTTPALWKSAWRLGLSHFIPFAVTIVA
ILFTDLLRGIGIGLVVGIAFIIAEHMRRPGLILVSPAGAILTRYVLPDQVTFLSKASIAR
ELEALPDSCRVEIDGRRTARFDYDALEVILAFRETARSRNIDYRLVGIPEVGLTPAH
Download sequence
Identical sequences C1AAY0
WP_015894155.1.17207 gi|226227750|ref|YP_002761856.1| 379066.GAU_2344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]