SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 379066.GAU_2381 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  379066.GAU_2381
Domain Number 1 Region: 205-475
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.08e-60
Family PFOR Pyr module 0.0086
Further Details:      
 
Domain Number 2 Region: 7-224
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.84e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0068
Further Details:      
 
Domain Number 3 Region: 489-592
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000982
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 379066.GAU_2381
Sequence length 612
Comment (Gemmatimonas aurantiaca T 27)
Sequence
MSGINDFAFKIGTVNGTGSASANGLLMQAIFRMGIPVSGKNIFPSNIQGLPTWYEIRVSK
DGYMARPSEVDLVVALNPATYAKDVATVRPGGYLLYDSSWPLDPDLVREGITIMGIPFGR
LCVENFQGDRDRTLLRNIVYAGSLAALLGIDMDVVSKMLEEKYGKKPKLLTSNHKAIQLG
YEYAKAHFTCPLPFSLEKMDHTSDSILIDGNTACALGAVYAGATVGAWYPITPATALMEQ
FKAFCDKFRVDKETGAHNYAILQAEDELSAAGIIIGAGWAGARAFTNTSGPGISLMQEFI
GLAYYTDIPAVFFDIQRCGPATGMPTRTQQADLLSLAYASHGDTKHLVIFPANPGEAFEM
SVQSFDLAERFQTPVFVATDLDIGMNDWMVKRFTWDDSYTPDRGKVLHKEDLEKIQKFSR
YLDVDGDGIAARTLPGVGGKGAYFVRGSGHDKHAAYTEDSDAYQELVDRLKRKFEHAATA
MPKPVFTLQDGADVGLVTLGGCDAAVREAADKLRAQGIVADVMRVRAFPFGAEVKDFFSR
HERVFVIEQNRDAQLRSLLAIELGIPRDSMLSIVDYGGMPLTAKVVVDAVSKKLGALGHV
PSTLGATNGVHA
Download sequence
Identical sequences C1AB17
WP_015894192.1.17207 379066.GAU_2381 gi|226227787|ref|YP_002761893.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]