SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 379731.PST_0154 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  379731.PST_0154
Domain Number 1 Region: 399-485
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000011
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 379731.PST_0154
Sequence length 495
Comment (Pseudomonas stutzeri A1501)
Sequence
MLQTIKQNWFSNLRGDLLSGLVVALALIPEAIAFSIIAGVDPRVGLYASFCIAVVIAFVG
GRPGMISAATGAMALLMVTLVREHGLQYLLAATLLCGLLQIGAGYLRLGSLMRFVSRSVV
TGFVNALAILIFMAQLPELTGVTWHVYAMTAAGLGIIYLFPHVPKLGKVIPSPLVCILSM
TAVAVYFGLDIRTVGDMGELPDTLPVFLWPEVPLNLETLAIIFPYSAALAVVGLLESLMT
ATIVDELTDTSSDKNRECKGQGVANIVSGLFGGMAGCAMIGQSVINVKSGGRTRLSTFVA
GVVLLLMVVFLSDWVGQIPMAALVAVMIMVSIGTFSWDSVRNLKHYPLSTNIVMVVTVVV
VVFTHNLAYGVLAGVLLAAMFFANKVGHYLSIDSELDADPSGRRYQVVGQVFFSSADKFT
AAFDFKEALSRVTIDLSRAHFWDITAVSALDKVVLKFRREGTEVEVLGLNEASATIVDRF
GVHDKPDAIDKLMSH
Download sequence
Identical sequences A4VFW0
WP_011911400.1.31855 gi|146280550|ref|YP_001170703.1| 379731.PST_0154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]