SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 379731.PST_1100 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  379731.PST_1100
Domain Number 1 Region: 458-558
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000196
Family Anti-sigma factor antagonist SpoIIaa 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 379731.PST_1100
Sequence length 576
Comment (Pseudomonas stutzeri A1501)
Sequence
MKLPPLFAAWRQALHLGYGARALRGDISAGLTVGIIAIPLAMALAIAVGVAPQHGLYTVL
VAAPLIALTGGSRFNVSGPTAAFVVILLPITQQFGLGGLLLCTMLAGLILITLGLLRAGR
LIAFIPYPVTLGFTAGIGIVIATLQIKDLFGLTLSEQPQHYVEQVGLLLRSLPSAHLGDA
LVAVICLTVLIVWPRWVPKIPGHLVALTVGAVAGALLESSGLSVATLGERFSYTLDGVTH
PGIPPFLPDFAWPWLLPGPDGQPLELSYELFRQLLAPAFAIAMLGAIESLLCAVVADGMT
GSSHEPNGELIGQGLGNLVAPLFGGITATAAIARSATNVRAGAFSPLASMIHAGVVLVAI
LWLAPLFSYLPMAALAALLVMVAWNMSEAPHVMHVLRIAPRSDVLVLLTCLILTVLFDMV
LAVGVGLLLAAGLFIKRMSELTDTTALSREQRRILRDMPEHVATYAIRGPLFFGAAEKAL
GALRRFNPEVKVVIVDISAVPMLDMTALASLENVLVDYRRLGVTLILSGSSAQVRLKLRR
AGIHRLQGHLLYVRNLTQAREKALRLLRPEPDPAPV
Download sequence
Identical sequences A4VIJ6 F2N1H8 S6L2T3
gi|146281486|ref|YP_001171639.1| gi|386019690|ref|YP_005937714.1| 379731.PST_1100 WP_011912285.1.31855 WP_011912285.1.43901 WP_011912285.1.45895 WP_011912285.1.98540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]