SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 379731.PST_3890 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  379731.PST_3890
Domain Number 1 Region: 12-205
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.5e-28
Family Clp protease, ClpP subunit 0.022
Further Details:      
 
Domain Number 2 Region: 378-444
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000116
Family NfeD domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 379731.PST_3890
Sequence length 458
Comment (Pseudomonas stutzeri A1501)
Sequence
MPRHPARWLLALLFALAVQSASAADPVTLLRVDGAIGPASADYILRGLQHARDEGAQLVV
LELDTPGGLDTSMRAIIKAILASPIPVATYVTPSGARAASAGTYMLYASHVAAMAPGTNL
GAATPVQIGGMPGAPPEQPKGEREDDAKASGDALARKQVNDAAAYIRGLAQLRERNAEWA
EQAVREAVSLSASEALKLKVIDYLARDVADLLRQLDGKTLATIEGEVRLQTADARLIEHA
PDWRVRLLAVITNPSVALILMMIGIYGLILEFSNPGMGAGGVLGGICLILALYALQLLPV
NYAGVALILLGIAFMVAEAFLPSFGVLGIGGVAAFVAGAVILIDTEVPGFGIPLSLIVPL
GFASALLVFAIVAMALKARRQRLVGGDAELIGSLAPVTGISAQDPHSGWVHLQGENWQVR
SATPLQVGQQVRVVAREGLQLNVAAQPSSNREELNHGL
Download sequence
Identical sequences A4VRB2
gi|146284202|ref|YP_001174355.1| WP_011914897.1.31855 379731.PST_3890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]