SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 380394.Lferr_0341 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  380394.Lferr_0341
Domain Number 1 Region: 7-103
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000012
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 380394.Lferr_0341
Sequence length 105
Comment (Acidithiobacillus ferrooxidans ATCC 53993)
Sequence
MSAANSWERRTVDGAGWLFLRGDWRVAQLDKALQFFSWAKDGRDCTEISVAELDAADSAT
LAVLLEWTQQAAGRGVPLRIHGASPKLRELASLYSLQDILPLCHD
Download sequence
Identical sequences B5EL79 E6QCX8 F8XP57
gi|198282481|ref|YP_002218802.1| 380394.Lferr_0341 WP_009563460.1.13253 WP_009563460.1.28209 WP_009563460.1.49158 WP_009563460.1.50737 WP_009563460.1.90948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]