SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 380394.Lferr_2543 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  380394.Lferr_2543
Domain Number 1 Region: 9-96,143-274
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0000000000038
Family Protein prenyltransferases 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 380394.Lferr_2543
Sequence length 292
Comment (Acidithiobacillus ferrooxidans ATCC 53993)
Sequence
MTGTDMDDDQKLWARAQNYVLSRQSADSGFCFYRVWGVEESTAPDTFYAVAMLRLWGMAI
PHRAELIRWLQSLQDDQGRYSSLTNASFGVRALSLLADTPLRDPRPHLLNWATQATGHKN
AASSETLRDWQRCVQLQRMLAPDEPLPEIMRSGAEAILHGMEAAAGGFGSHPNLVDSGIA
WALQRLLGQPLRPQDRIFLHACEDATLGLRLSPDGASTRLEAIFWGILQMAHLHIAPRYP
EAVMAYVRACQPVNGGFGRRAGAIATLEGTFHAVMIAAGLSRNPLLQTLTGI
Download sequence
Identical sequences B5EPU2
380394.Lferr_2543 gi|198284623|ref|YP_002220944.1| WP_012537479.1.13253 WP_012537479.1.28209 WP_012537479.1.49158 WP_012537479.1.50737 WP_012537479.1.90948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]