SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 380703.AHA_1633 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  380703.AHA_1633
Domain Number 1 Region: 5-149
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.78e-19
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 380703.AHA_1633
Sequence length 155
Comment (Aeromonas hydrophila ATCC 7966)
Sequence
MTDPIRIETGLPMLLGGLRRHHAFAHADFGGQWRDFCALGPLPGQLGEHAYGVICGVTAT
ECEYLCAVEVAALEVLPKTLGRMRIEPQTYAVFLHQGHVSAMPHTWQQALDWLAQSAYQS
AHKPDFERYGAAFDPETGSGEVELWLAVLPRQAIV
Download sequence
Identical sequences A0A1B8Z1P5 A0KIR8
380703.AHA_1633 WP_011705526.1.12787 WP_011705526.1.28436 WP_011705526.1.41987 WP_011705526.1.62309 WP_011705526.1.67280 YP_856169.1.44769 gi|117617522|ref|YP_856169.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]